- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-MAVS (ARP49559_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human VISA |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Human: 100% |
Peptide Sequence | Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-MAVS (ARP49559_P050) antibody is Catalog # AAP49559 (Previous Catalog # AAPS22410) |
Reference | Lad,S.P., (2008) Mol. Immunol. 45 (8), 2277-2287 |
Gene Symbol | MAVS |
---|---|
Gene Full Name | Mitochondrial antiviral signaling protein |
Alias Symbols | IPS1, VISA, IPS-1, CARDIF |
NCBI Gene Id | 57506 |
Protein Name | Mitochondrial antiviral-signaling protein |
Description of Target | Double-stranded RNA viruses are recognized in a cell type-dependent manner by the transmembrane receptor TLR3 or by the cytoplasmic RNA helicases MDA5 and RIGI (ROBO3). These interactions initiate signaling pathways that differ in their initial steps but converge in the activation of the protein kinases IKKA (CHUK) and IKKB (IKBKB), which activate NFKB, or TBK1 and IKKE (IKBKE), which activate IRF3. Activated IRF3 and NFKB induce transcription of IFNB (IFNB1). For the TLR3 pathway, the intermediary molecule before the pathways converge is the cytoplasmic protein TRIF (TICAM1). For RIGI, the intermediary protein is mitochondria-bound VISA. Double-stranded RNA viruses are recognized in a cell type-dependent manner by the transmembrane receptor TLR3 (MIM 603029) or by the cytoplasmic RNA helicases MDA5 (MIM 606951) and RIGI (ROBO3; MIM 608630). These interactions initiate signaling pathways that differ in their initial steps but converge in the activation of the protein kinases IKKA (CHUK; MIM 600664) and IKKB (IKBKB; MIM 603258), which activate NFKB (see MIM 164011), or TBK1 (MIM 604834) and IKKE (IKBKE; MIM 605048), which activate IRF3 (MIM 603734). Activated IRF3 and NFKB induce transcription of IFNB (IFNB1; MIM 147640). For the TLR3 pathway, the intermediary molecule before the pathways converge is the cytoplasmic protein TRIF (TICAM1; MIM 607601). For RIGI, the intermediary protein is mitochondria-bound IPS1 (Sen and Sarkar, 2005 [PubMed 16239922]).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | Q2HWT5 |
Protein Accession # | NP_065797 |
Nucleotide Accession # | NM_020746 |
Protein Size (# AA) | 896 |
Molecular Weight | 56kDa |
Protein Interactions | MIB2; KCNIP3; DDX58; UBC; TRAF6; TRAF3; UBXN1; TMEM173; SMURF2; HCVgp1; AMFR; MFN1; MFN2; MUL1; TOMM70A; FLOT2; NDFIP1; SMURF1; TBK1; IKBKG; TICAM1; TRAF2; MAP3K7; SRC; IRF7; IRF3; IKBKE; TSPAN6; RARRES3; ECSIT; PCBP2; ITCH; IFIH1; PSMA7; WDR5; HECTD3; PD |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "VISA Antibody - C-terminal region (ARP49559_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "VISA Antibody - C-terminal region (ARP49559_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "VISA Antibody - C-terminal region (ARP49559_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "VISA Antibody - C-terminal region (ARP49559_P050)"?
This target may also be called "IPS1, VISA, IPS-1, CARDIF" in publications.
-
What is the shipping cost for "VISA Antibody - C-terminal region (ARP49559_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "VISA Antibody - C-terminal region (ARP49559_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "VISA Antibody - C-terminal region (ARP49559_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "56kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "VISA Antibody - C-terminal region (ARP49559_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MAVS"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MAVS"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MAVS"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MAVS"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MAVS"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MAVS"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.