- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for VHL Antibody (Phospho-Ser68) (OAAF07854) |
---|
Predicted Species Reactivity | Human|Mouse|Rat |
---|---|
Product Format | Liquid. Supplied in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
Additional Information | Modification Sites: Human:S68, Mouse:S34, Rat:S34 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human VHL around the phosphorylation site of Ser68. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: GAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRV |
Concentration | 1mg/ml |
Specificity | VHL (Phospho-Ser68) Antibody detects endogenous levels of VHL only when phosphorylated at Ser68. |
Application Info | IHC: 1:50~1:100 ELISA: 1:10000 |
Gene Symbol | VHL |
---|---|
Gene Full Name | von Hippel-Lindau tumor suppressor |
Alias Symbols | elongin binding protein;HRCA1;protein G7;pVHL;RCA1;VHL1;von Hippel-Lindau disease tumor suppressor;von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase. |
NCBI Gene Id | 7428 |
Protein Name | von Hippel-Lindau disease tumor suppressor |
Description of Target | Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2. |
Uniprot ID | P40337 |
Molecular Weight | 24 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "VHL Antibody (Phospho-Ser68) (OAAF07854)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "VHL Antibody (Phospho-Ser68) (OAAF07854)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "VHL Antibody (Phospho-Ser68) (OAAF07854)" provided in?
This item is provided in "Liquid. Supplied in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "VHL Antibody (Phospho-Ser68) (OAAF07854)"?
This target may also be called "elongin binding protein;HRCA1;protein G7;pVHL;RCA1;VHL1;von Hippel-Lindau disease tumor suppressor;von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase." in publications.
-
What is the shipping cost for "VHL Antibody (Phospho-Ser68) (OAAF07854)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "VHL Antibody (Phospho-Ser68) (OAAF07854)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "VHL Antibody (Phospho-Ser68) (OAAF07854)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "24 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "VHL Antibody (Phospho-Ser68) (OAAF07854)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "VHL"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "VHL"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "VHL"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "VHL"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "VHL"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "VHL"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.