Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OAAF07854
Size:100 ug
Price: $344.00
SKU
OAAF07854
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

VHL Antibody (Phospho-Ser68) (OAAF07854)

Datasheets/ManualsPrintable datasheet for VHL Antibody (Phospho-Ser68) (OAAF07854)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
Product FormatLiquid. Supplied in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Additional InformationModification Sites: Human:S68, Mouse:S34, Rat:S34
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human VHL around the phosphorylation site of Ser68.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: GAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRV
Concentration1mg/ml
SpecificityVHL (Phospho-Ser68) Antibody detects endogenous levels of VHL only when phosphorylated at Ser68.
Application Info
IHC: 1:50~1:100
ELISA: 1:10000
Gene SymbolVHL
Gene Full Namevon Hippel-Lindau tumor suppressor
Alias Symbolselongin binding protein;HRCA1;protein G7;pVHL;RCA1;VHL1;von Hippel-Lindau disease tumor suppressor;von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase.
NCBI Gene Id7428
Protein Namevon Hippel-Lindau disease tumor suppressor
Description of TargetInvolved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2.
Uniprot IDP40337
Molecular Weight24 kDa
  1. What is the species homology for "VHL Antibody (Phospho-Ser68) (OAAF07854)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "VHL Antibody (Phospho-Ser68) (OAAF07854)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "VHL Antibody (Phospho-Ser68) (OAAF07854)" provided in?

    This item is provided in "Liquid. Supplied in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "VHL Antibody (Phospho-Ser68) (OAAF07854)"?

    This target may also be called "elongin binding protein;HRCA1;protein G7;pVHL;RCA1;VHL1;von Hippel-Lindau disease tumor suppressor;von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase." in publications.

  5. What is the shipping cost for "VHL Antibody (Phospho-Ser68) (OAAF07854)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "VHL Antibody (Phospho-Ser68) (OAAF07854)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "VHL Antibody (Phospho-Ser68) (OAAF07854)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "24 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "VHL Antibody (Phospho-Ser68) (OAAF07854)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "VHL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "VHL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "VHL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "VHL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "VHL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "VHL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:VHL Antibody (Phospho-Ser68) (OAAF07854)
Your Rating
We found other products you might like!