Catalog No: OPCA05317
Price: $0.00
SKU
OPCA05317
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
VERTEBRATE ANCIENT OPSIN Recombinant Protein (Atlantic salmon) (OPCA05317)
Datasheets/Manuals | Printable datasheet for VERTEBRATE ANCIENT OPSIN Recombinant Protein (Atlantic salmon) (OPCA05317) (OPCA05317) |
---|
Predicted Species Reactivity | Atlantic Salmon|Salmo salar |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Salmo salar(Atlantic salmon) |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN |
Protein Sequence | MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 1-75 aa |
Tag | N-terminal 6xHis-SUMO-tagged |
Reference | A novel and ancient vertebrate opsin.Soni B.G., Foster R.G.FEBS Lett. 406:279-283(1997) |
Gene Symbol | LOC100136521 |
---|---|
Gene Full Name | vertebrate ancient opsin |
Alias Symbols | vertebrate ancient opsin. |
NCBI Gene Id | 100136521 |
Protein Name | Vertebrate ancient opsin |
Uniprot ID | O13018 |
Protein Accession # | NP_001117098 |
Nucleotide Accession # | NM_001123626 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 24.5 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review