VERTEBRATE ANCIENT OPSIN Recombinant Protein (Atlantic salmon) (OPCA05317)

Catalog No: OPCA05317

Product Info

• Predicted Species Reactivity: Atlantic Salmon|Salmo salar
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Salmo salar(Atlantic salmon)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN
• Protein Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-75 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: A novel and ancient vertebrate opsin.Soni B.G., Foster R.G.FEBS Lett. 406:279-283(1997)

Target Info

• Gene Symbol: LOC100136521
• Gene Full Name: vertebrate ancient opsin
• Alias Symbols: vertebrate ancient opsin.
• NCBI Gene Id: 100136521
• Protein Name: Vertebrate ancient opsin
• Uniprot ID: O13018
• Protein Accession #: NP_001117098
• Nucleotide Accession #: NM_001123626
• Protein Size (# AA): Recombinant
• Molecular Weight: 24.5 kDa