Search Antibody, Protein, and ELISA Kit Solutions

VEGFB Antibody - middle region (ARP58975_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58975_P050-FITC Conjugated

ARP58975_P050-HRP Conjugated

ARP58975_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Vascular endothelial growth factor B
NCBI Gene Id:
Protein Name:
Vascular endothelial growth factor B
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-101581 from Santa Cruz Biotechnology.
Description of Target:
Vascular endothelial growth factor B (VEGFB) signals via the endothelial receptor VEGFR1 (MIM 165070) and is a regulator of blood vessel physiology, with a role in endothelial targeting of lipids to peripheral tissues (summarized by Hagberg et al., 2010 [PubMed 20228789]).
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VEGFB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VEGFB.
The immunogen is a synthetic peptide directed towards the middle region of human VEGFB
Predicted Homology Based on Immunogen Sequence:
Cow: 87%; Dog: 80%; Horse: 92%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 86%
Complete computational species homology data:
Anti-VEGFB (ARP58975_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-VEGFB (ARP58975_P050) antibody is Catalog # AAP58975 (Previous Catalog # AAPP44942)
Printable datasheet for anti-VEGFB (ARP58975_P050) antibody
Sample Type Confirmation:

VEGFB is supported by BioGPS gene expression data to be expressed in ACHN

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...