Catalog No: OPCA04133
Price: $0.00
SKU
OPCA04133
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for VEGFA Recombinant Protein (Rabbit) (OPCA04133) (OPCA04133) |
---|
Predicted Species Reactivity | Rabbit |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Oryctolagus cuniculus (Rabbit) |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR |
Protein Sequence | YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Yeast |
Protein Range | 51-511 aa |
Tag | N-terminal 6xHis-tagged |
Gene Symbol | VEGFA |
---|---|
Protein Name | PREDICTED: vascular endothelial growth factor A [Oryctolagus cuniculus] |
Uniprot ID | XP_002714743.1 |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/XP_002714743.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 51.7 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!