VEGFA Antibody - middle region (ARP86731_P050)

Catalog No: ARP86731_P050

Host: Rabbit
Target Name: VEGFA
Sample Tissue: Human LN18 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of human VEGFA
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: QGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-VEGFA (ARP86731_P050) antibody is Catalog # AAP86731

Target Info

• Gene Symbol: VEGFA
• Gene Full Name: vascular endothelial growth factor A
• Alias Symbols: VPF, VEGF, MVCD1
• NCBI Gene Id: 7422
• Protein Name: Vascular endothelial growth factor A
• Description of Target: This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome. Allelic variants of this gene have been associated with microvascular complications of diabetes 1 (MVCD1) and atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been described. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site.
• Uniprot ID: P15692-14
• Protein Accession #: NP_001020537.2
• Nucleotide Accession #: NM_001025366.2
• Protein Size (# AA): 412
• Molecular Weight: 45 kDa