- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-VEGFA (ARP60980_P050-HRP) antibody |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | HRP: Horseradish Peroxidase |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human VEGFA |
Purification | Affinity Purified |
Peptide Sequence | Synthetic peptide located within the following region: ECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSL |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-VEGFA (ARP60980_P050-HRP) antibody is Catalog # AAP60980 |
Gene Symbol | VEGFA |
---|---|
Alias Symbols | VPF, VEGF, MVCD1 |
NCBI Gene Id | 7422 |
Description of Target | This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. |
Uniprot ID | P15692-12 |
Protein Size (# AA) | 327 |
Molecular Weight | 35kDa |
Protein Interactions | ILF3; HNRNPL; NRP1; FLT1; LYVE1; KDR; PRRG4; VPS35; U2AF1; Flt4; ELAVL1; CRYAB; HNRNPD; HGS; UBC; HSP90AA1; HSPA4; YBX3; ADAMTS1; IGFBP7; NRP2; VEGFB; SEMA3F; PGF; EPHB2; TNXB; GPC1; VTN; VEGFA; SPARC; AKT1; YBX1; CTGF; RB1; HIF1A; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "VEGFA Antibody - C-terminal region : HRP (ARP60980_P050-HRP)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "VEGFA Antibody - C-terminal region : HRP (ARP60980_P050-HRP)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "VEGFA Antibody - C-terminal region : HRP (ARP60980_P050-HRP)" provided in?
This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "VEGFA Antibody - C-terminal region : HRP (ARP60980_P050-HRP)"?
This target may also be called "VPF, VEGF, MVCD1" in publications.
-
What is the shipping cost for "VEGFA Antibody - C-terminal region : HRP (ARP60980_P050-HRP)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "VEGFA Antibody - C-terminal region : HRP (ARP60980_P050-HRP)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "VEGFA Antibody - C-terminal region : HRP (ARP60980_P050-HRP)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "35kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "VEGFA Antibody - C-terminal region : HRP (ARP60980_P050-HRP)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "VEGFA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "VEGFA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "VEGFA"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "VEGFA"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "VEGFA"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "VEGFA"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.