Size:5ug
$59.00
In Stock
SKU
OOPA00214
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

VDR Protein (OOPA00214)

Catalog#: OOPA00214
Domestic: within 1 week delivery | International: 1 week
This product is Genway GWB-BSP716
More Information
Product Format Sterile filtered colorless solution.
Reconstitution and Storage Store at 4C if entire vial will be used within 2-4 weeks. Store, frozen at -20C for longer periods of time. Please avoid freeze thaw cycles.
Source Escherichia coli
Purity Greater than 70.0% as determined by SDS-PAGE.
Peptide Sequence MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYF QGEFMEAMAASTSLPDPGDFDRNVPRICGVCGDRATGF HFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNR RHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEE EALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFR PPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITS SDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADL VSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRS NESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIK FQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQD RLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHS KQYRCLSFQPECSMKLTPLVLEVFGNEIS.
Formulation VDR protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5.
Datasheets/Manuals Printable datasheet for OOPA00214
Gene Symbol VDR
Alias Symbols Vitamin D3 receptor, VDR, 1, 25-dihydroxyvitamin D3 receptor, Nuclear receptor subfamily 1 group I member 1, VDR, NR1I1.
Description of Target Vitamin D receptors (VDRs) belong to the NR1I family, which also includes pregnane X (PXR) and constitutive androstane (CAR) receptors which form heterodimers with members of the retinoid X receptor family. VDR is expressed in the intestine, thyroid and kidney and has an imperative role in calcium homeostasis. VDRs inhibit expression of 1alpha-hydroxylase (the proximal activator of 1,25(OH)2D3 and induce expression of the 1,25(OH)2D3 inactivating enzyme CYP24. Additionally, VDR has recently been recognized as an additional bile acid receptor alongside FXR and may function to protect gut against the toxic and carcinogenic effects of these endobiotics. Hereditary mutations in the VDR gene leads to rickets, which is typified by muscle weakness, growth retardation, bone deformity and secondary hyperparathyroidism. The human gene encoding the VDR is localized to chromosome 12q12-q14.
Write Your Own Review
You're reviewing:VDR Protein (OOPA00214)
Your Rating
We found other products you might like!