Search Antibody, Protein, and ELISA Kit Solutions

VDAC2 Antibody - N-terminal region (ARP35123_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP35123_P050-FITC Conjugated

ARP35123_P050-HRP Conjugated

ARP35123_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-32057 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human VDAC2
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Zebrafish: 86%
Complete computational species homology data:
Anti-VDAC2 (ARP35123_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-VDAC2 (ARP35123_P050) antibody is Catalog # AAP35123 (Previous Catalog # AAPP08406)
Printable datasheet for anti-VDAC2 (ARP35123_P050) antibody
Sample Type Confirmation:

VDAC2 is supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Chandra,D., (2005) J. Biol. Chem. 280 (19), 19051-19061

Hrabakova, R. et al. Cancer cell resistance to aurora kinase inhibitors: identification of novel targets for cancer therapy. J. Proteome Res. 12, 455-69 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 23151231

Gene Symbol:
Official Gene Full Name:
Voltage-dependent anion channel 2
Alias Symbols:
RP11-375G3.1, FLJ23841, POR
NCBI Gene Id:
Protein Name:
Voltage-dependent anion-selective channel protein 2
Description of Target:
VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VDAC2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VDAC2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...