Search Antibody, Protein, and ELISA Kit Solutions

VDAC1 Antibody - C-terminal region (ARP35122_T100)

100 ul

Regular Price: $249.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP35122_T100-FITC Conjugated

ARP35122_T100-HRP Conjugated

ARP35122_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-171785 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the C terminal region of human VDAC1
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-VDAC1 (ARP35122_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-VDAC1 (ARP35122_T100) antibody is Catalog # AAP35122 (Previous Catalog # AAPP06353)
Printable datasheet for anti-VDAC1 (ARP35122_T100) antibody
Sample Type Confirmation:

VDAC1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Zheng,Y., et al., (2004) Oncogene 23 (6), 1239-1247

Arduíno, D. M. et al. Mitochondrial metabolism in Parkinson’s disease impairs quality control autophagy by hampering microtubule-dependent traffic. Hum. Mol. Genet. 21, 4680-702 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22843496

Chen, S. et al. Reduced expression of lamin A/C results in modified cell signaling and metabolism coupled with changes in expression of structural proteins. J. Proteome Res. 8, 5196-211 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 19775189

Rousset, F., Nguyen, M. V. C., Grange, L., Morel, F. & Lardy, B. Heme oxygenase-1 regulates matrix metalloproteinase MMP-1 secretion and chondrocyte cell death via Nox4 NADPH oxidase activity in chondrocytes. PLoS One 8, e66478 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 23840483

Gene Symbol:
Official Gene Full Name:
Voltage-dependent anion channel 1
Alias Symbols:
NCBI Gene Id:
Protein Name:
Voltage-dependent anion-selective channel protein 1
Description of Target:
The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VDAC1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VDAC1.
Protein Interactions:

Product Reviews

Average Rating:
3 reviews
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

3 Item(s)

122/05/2019 23:04
  • Overall Experience:
  • Quality:
Mouse brain, subcellular fractions in IP

Submitted by: Anonymous


Host: Rabbit

Immunoprecipitation of endogenous VDAC protein from CHO cells transfected with empty vector (CHO P4) or with mutated APP (amyloid precursor protein [CHO APP-LDN])

Sample type: Mouse brain, subcellular fractions.

1- Preclearing: 40 ug proteins were incubated with 50 ul IgG A beads for 1h at 4°C on a wheel, then centrifuged at 1200 rpm for 5 min. Supernatant is conserved for the experiment.

2- IP: Supernatant is incubated with 4 ul Aviva antibody over night at 4°C on wheel.

3- The day after: addition of 50 ul IgG A beads and incubation for 3h at 4°C on wheel.

4- Washing with PBS+protease inhibitors+NP40 0.5% (2 times).

5- Addition of 2x Laemli buffer on washed beads and heating at 100°C for 5 min.

6- Centrifugation and loading of supernatant on SDS-Acrylamide gel.

Show more comments (-2) Hide comments
122/05/2019 23:03
  • Overall Experience:
  • Quality:
Mouse brain, subcellular fractions in WB

Submitted by:


Sample type: Mouse brain, subcellular fractions (homogenate, crude mitochondria, pure mitochondria, microsomes, mitochondrial associated membranes).
Lane 1: 30ug mouse brain subcellular fraction (mitochondria associated membranes)
Lane 2: 30ug mouse brain subcellular fraction (endoplasmic reticulum)
Lane 3: 30ug mouse brain subcellular fraction (pure mitochondria)
Lane 4: 30ug mouse brain subcellular fraction (crude mitochondria)
Lane 5: 30ug mouse brain homogenate

Sample preparation method: ref: Wieckowski MR, Nature protocols, 2009; 4(11):1582-90.

Primary antibody dilution: 1:5000

Secondary antibody and dilution: 1:2000

Show more comments (-2) Hide comments
02/01/2017 15:23
  • Overall Experience:
  • Quality:
Product Review: VDAC1 antibody - C-terminal region (ARP35122_T100) in HeLa cell and MDA-MB-231 Human breast carcinoma cell line using Western blot

Product page for VDAC1 antibody - C-terminal region (ARP35122_T100)

Researcher: David Colecchia, Ph.D, Istituto Toscano Tumori, Core Research Laboratory, presso Fondazione Toscana Life Sciences
Application: Western blotting
Species + Tissue/Cell type: Lane 1: 50ug HeLa lysate Lane 2: 50ug 293T lysate Lane 3: 50ug K562 lysate Lane 4: 50ug MDA-MB-231 lysate
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:1000

How do Aviva's reagents play a role in your experimental goals? It works as good by WB.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4, it works quite well on endogenous protein.
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, because signal is clean
How did you store the antibody after re-suspension? Frozen at -20 degree C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Human cancer cell line: Hela, 293T, K562, MDA-231. 50 micrograms per lane.
How many different experimental trials were conducted using the antibody sample? Three
How was this sample prepared? Cells were washed in PBS and lysed in Ripa buffer. Lysates were cleared by centrifugation at 15000g for 10 minutes. Then lysates were quantified by Bradford. Laemmli 5X was added to each sample  of 50 ug of protein and was boiled and loaded.
Primary antibody dilution and incubation time: 1:200 in TBS-Tween 0.1% and milk 5%. 2 hours
Secondary antibody used and dilution and incubation time: Anti-rabbit-HRP (Santacruz, sc-2000) 1:1000. 1 hour.
What controls were used in your experiment (positive/negative)? Human cancer cell lines
Please include your detailed WB Procedure/Protocol here: Protein electrophoresis on SDS-PAGE 8% gel. Tranfer wet 1 hour at 400 mA at 4 degree C on PVDF membrane. Wash in TBS-T 5 minutes. Blocking o/n in 5% milk TBS-T with agitation at 4 degree C. Primary Antibody for 2 hours. 4 washes in TBS-T for 5 minutes. Secondary Antibody for 1 hour. 4 washes in TBS-T for 5 minutes. ECL used for chemioluminescence.
Show more comments (-2) Hide comments

3 Item(s)

What kind of abuse are you reporting?
    Please, wait...