Now Offering Over 102,157 Antibodies & 44,722 Antigens!

VDAC1 antibody - C-terminal region (ARP35122_T100)

100 ul
$249.00
In Stock

Conjugation Options

ARP35122_T100-FITC Conjugated

ARP35122_T100-HRP Conjugated

ARP35122_T100-Biotin Conjugated

Gene Symbol:
VDAC1
NCBI Gene Id:
7416
Official Gene Full Name:
Voltage-dependent anion channel 1
Protein Name:
Voltage-dependent anion-selective channel protein 1
Swissprot Id:
Q5FVE7
Protein Accession #:
NP_003365
Nucleotide Accession #:
NM_003374
Alias Symbols:
PORIN, VDAC-1
Replacement Item:
This antibody may replace item sc-171785 from Santa Cruz Biotechnology.
Description of Target:
The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.
Protein Size (# AA):
283
Molecular Weight:
31kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VDAC1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VDAC1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human VDAC1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-VDAC1 (ARP35122_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; KLHL40; SPRTN; MDM2; ADRB2; ASB14; ASB17; PARK2; BAG3; env; VCAM1; HK1; ATF2; FMNL1; TUBA1B; MDC1; CAV1; Htt; SFXN3; SUGP1; UBAP2; UFM1; ACAD9; MGAT4B; ACAA2; ZMPSTE24; VAPA; ALDH5A1; SF1; VDAC3; VDAC2; UBA52; TIAL1; FLOT2; CDK2; SIRT7; SUMO4; MAPK3;
Blocking Peptide:
For anti-VDAC1 (ARP35122_T100) antibody is Catalog # AAP35122 (Previous Catalog # AAPP06353)
Datasheets/Manuals:
Printable datasheet for anti-VDAC1 (ARP35122_T100) antibody
Sample Type Confirmation:

VDAC1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Zheng,Y., et al., (2004) Oncogene 23 (6), 1239-1247
Publications:

Chen, S. et al. Reduced expression of lamin A/C results in modified cell signaling and metabolism coupled with changes in expression of structural proteins. J. Proteome Res. 8, 5196-211 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 19775189

Arduíno, D. M. et al. Mitochondrial metabolism in Parkinson’s disease impairs quality control autophagy by hampering microtubule-dependent traffic. Hum. Mol. Genet. 21, 4680-702 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22843496

Rousset, F., Nguyen, M. V. C., Grange, L., Morel, F. & Lardy, B. Heme oxygenase-1 regulates matrix metalloproteinase MMP-1 secretion and chondrocyte cell death via Nox4 NADPH oxidase activity in chondrocytes. PLoS One 8, e66478 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 23840483

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: VDAC1 antibody - C-terminal region (ARP35122_T100) in HeLa cell and MDA-MB-231 Human breast carcinoma cell line using Western blot
Product page for VDAC1 antibody - C-terminal region (ARP35122_T100)

Researcher: David Colecchia, Ph.D, Istituto Toscano Tumori, Core Research Laboratory, presso Fondazione Toscana Life Sciences
Application: Western blotting
Species + Tissue/Cell type: Lane 1: 50ug HeLa lysate Lane 2: 50ug 293T lysate Lane 3: 50ug K562 lysate Lane 4: 50ug MDA-MB-231 lysate
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit-HRP
Secondary antibody dilution: 1:1000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? It works as good by WB.
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4, it works quite well on endogenous protein.
Would you use this antibody in future experiments? Yes
Have you used another antibody which has worked in your application? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not? Yes, because signal is clean
How did you store the antibody after re-suspension? Frozen at -20 degree C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): Human cancer cell line: Hela, 293T, K562, MDA-231. 50 micrograms per lane.
How many different experimental trials were conducted using the antibody sample? Three
How was this sample prepared? Cells were washed in PBS and lysed in Ripa buffer. Lysates were cleared by centrifugation at 15000g for 10 minutes. Then lysates were quantified by Bradford. Laemmli 5X was added to each sample  of 50 ug of protein and was boiled and loaded.
Primary antibody dilution and incubation time: 1:200 in TBS-Tween 0.1% and milk 5%. 2 hours
Secondary antibody used and dilution and incubation time: Anti-rabbit-HRP (Santacruz, sc-2000) 1:1000. 1 hour.
What controls were used in your experiment (positive/negative)? Human cancer cell lines
Please include your detailed WB Procedure/Protocol here: Protein electrophoresis on SDS-PAGE 8% gel. Tranfer wet 1 hour at 400 mA at 4 degree C on PVDF membrane. Wash in TBS-T 5 minutes. Blocking o/n in 5% milk TBS-T with agitation at 4 degree C. Primary Antibody for 2 hours. 4 washes in TBS-T for 5 minutes. Secondary Antibody for 1 hour. 4 washes in TBS-T for 5 minutes. ECL used for chemioluminescence.
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...