Search Antibody, Protein, and ELISA Kit Solutions

VCAM1 Antibody - C-terminal region : FITC (ARP74339_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74339_P050 Unconjugated

ARP74339_P050-HRP Conjugated

ARP74339_P050-Biotin Conjugated

Gene Symbol:
VCAM1
NCBI Gene Id:
7412
Swissprot Id:
P19320
Alias Symbols:
VCAM1, L1CAM,
Replacement Item:
This antibody may replace item sc-13160 from Santa Cruz Biotechnology.
Description of Target:
This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.
Protein Size (# AA):
739
Molecular Weight:
81kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VCAM1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VCAM1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human VCAM1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
NCL; MSN; ITGA4; ACTB; FSCN1; SLC2A1; SFPQ; PPIAP22; HIST2H4B; BOLA2; HIST2H3A; HNRNPA3; TUBB; CHMP4B; HIST2H3C; RAVER1; MSI2; ARAP1; STON2; HIST1H2BK; MRPL43; NTPCR; FERMT3; NAA15; CPSF7; SMAP2; LY6G5B; XPO5; THOC2; SEPT11; ATAD3A; HEATR1; NSUN2; MRPS23;
Blocking Peptide:
For anti-VCAM1 (ARP74339_P050-FITC) antibody is Catalog # AAP74339
Datasheets/Manuals:
Printable datasheet for anti-VCAM1 (ARP74339_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...