Protein on Demand™ VC0678 Recombinant Protein (Vibrio cholerae serotype O1) (OPCA61162)

Catalog No: OPCA61162

Product Info

• Predicted Species Reactivity: Vibrio cholerae serotype O1
• Product Format: Lyophilized powder
• Application: WB, ELISA
• Additional Information: For Research Use Only.
  Sterile filtering available upon request.
  Low endotoxin available upon request.
• Reconstitution and Storage: Briefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20C/-80C. Our in house default final concentration of glycerol is 50% for reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: MPYLKGAPMNLQEMEKNSAKAVVLLKAMANERRLQILCMLLDNELSVGELSSRLELSQSALSQHLAWLRRDGLVNTRKEAQTVFYTLSSTEVKAMIELLHRLYCQANQ
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Tag: This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.

Target Info

• Gene Symbol: VC0678
• NCBI Gene Id: 2615467
• Uniprot ID: P52695
• Protein Size (# AA): 108