Size:100 ul
$125.00
In Stock
SKU
ARP59666_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP59666_P050-FITC Conjugated

ARP59666_P050-HRP Conjugated

ARP59666_P050-Biotin Conjugated

VAV3 Antibody (ARP59666_P050)

Catalog#: ARP59666_P050
Domestic: within 1 week delivery | International: 1 week
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the following sequence DETLVEDEEDLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-VAV3 (ARP59666_P050)
Peptide Sequence Synthetic peptide located within the following region: DETLVEDEEDLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide Available upon request
Datasheets/Manuals Printable datasheet for anti-VAV3 (ARP59666_P050) antibody
Gene Symbol VAV3
Official Gene Full Name vav 3 guanine nucleotide exchange factor
NCBI Gene Id 10451
Protein Name Guanine nucleotide exchange factor VAV3
Description of Target This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. This gene product acts as a GEF preferentially for RhoG, RhoA, and to a lesser extent, RAC1, and it associates maximally with the nucleotide-free states of these GTPases. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Swissprot Id Q9UKW4
Protein Accession # NP_006104
Nucleotide Accession # NM_001079874
Protein Size (# AA) 847
Molecular Weight 98 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express VAV3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express VAV3.
Protein Interactions UBC; GRB2; ESR1; ERBB3; ERBB2; BLNK; SH3BP2; RAC1; ZYX; LCP2; SHC1; RHOG; PLCG1; PIK3R1; RHOA; ROS1; INSR; IGF1R; EGFR; PDGFRB;
  1. What is the species homology for "VAV3 Antibody (ARP59666_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "VAV3 Antibody (ARP59666_P050)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "VAV3 Antibody (ARP59666_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "VAV3 Antibody (ARP59666_P050)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "VAV3 Antibody (ARP59666_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "VAV3 Antibody (ARP59666_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "VAV3 Antibody (ARP59666_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "98 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "VAV3 Antibody (ARP59666_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "VAV3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "VAV3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "VAV3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "VAV3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "VAV3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "VAV3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:VAV3 Antibody (ARP59666_P050)
Your Rating