Search Antibody, Protein, and ELISA Kit Solutions

VAV3 Antibody (ARP59666_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$125.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP59666_P050-FITC Conjugated

ARP59666_P050-HRP Conjugated

ARP59666_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
VAV3
Official Gene Full Name:
vav 3 guanine nucleotide exchange factor
NCBI Gene Id:
10451
Protein Name:
Guanine nucleotide exchange factor VAV3
Swissprot Id:
Q9UKW4
Protein Accession #:
NP_006104
Nucleotide Accession #:
NM_001079874
Description of Target:
This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. This gene product acts as a GEF preferentially for RhoG, RhoA, and to a lesser extent, RAC1, and it associates maximally with the nucleotide-free states of these GTPases. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Protein Size (# AA):
847
Molecular Weight:
98 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VAV3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VAV3.
Immunogen:
The immunogen is a synthetic peptide directed towards the following sequence DETLVEDEEDLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLA
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-VAV3 (ARP59666_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DETLVEDEEDLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; GRB2; ESR1; ERBB3; ERBB2; BLNK; SH3BP2; RAC1; ZYX; LCP2; SHC1; RHOG; PLCG1; PIK3R1; RHOA; ROS1; INSR; IGF1R; EGFR; PDGFRB;
Blocking Peptide:
Available upon request
Datasheets/Manuals:
Printable datasheet for anti-VAV3 (ARP59666_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...