VASH1 Antibody - N-terminal region : Biotin (ARP55099_P050-Biotin)

Catalog No: ARP55099_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VASH1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-VASH1 (ARP55099_P050-Biotin) antibody is Catalog # AAP55099 (Previous Catalog # AAPP32717)
• Reference: Yoshinaga,K., (2008) Cancer Sci. 99 (5), 914-919

Target Info

• Gene Symbol: VASH1
• Gene Full Name: Vasohibin 1
• Alias Symbols: TTCP 1, KIAA1036
• NCBI Gene Id: 22846
• Protein Name: Vasohibin-1
• Description of Target: VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
• Uniprot ID: Q7L8A9
• Protein Accession #: NP_055724
• Nucleotide Accession #: NM_014909
• Protein Size (# AA): 365
• Molecular Weight: 41kDa
• Protein Interactions: DHPS; CCDC23;