Search Antibody, Protein, and ELISA Kit Solutions

VASH1 Antibody - N-terminal region (ARP55099_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP55099_P050-FITC Conjugated

ARP55099_P050-HRP Conjugated

ARP55099_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
VASH1
Official Gene Full Name:
Vasohibin 1
NCBI Gene Id:
22846
Protein Name:
Vasohibin-1
Swissprot Id:
Q7L8A9
Protein Accession #:
NP_055724
Nucleotide Accession #:
NM_014909
Alias Symbols:
KIAA1036
Replacement Item:
This antibody may replace item sc-49777 from Santa Cruz Biotechnology.
Description of Target:
VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Protein Size (# AA):
365
Molecular Weight:
41kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VASH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VASH1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human VASH1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-VASH1 (ARP55099_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
DHPS; CCDC23;
Blocking Peptide:
For anti-VASH1 (ARP55099_P050) antibody is Catalog # AAP55099 (Previous Catalog # AAPP32717)
Datasheets/Manuals:
Printable datasheet for anti-VASH1 (ARP55099_P050) antibody
Target Reference:
Yoshinaga,K., (2008) Cancer Sci. 99 (5), 914-919

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...