VASH1 Antibody - middle region (ARP55100_P050)

Catalog No: ARP55100_P050

WB Suggested Anti-VASH1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VASH1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: SVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-VASH1 (ARP55100_P050) antibody is Catalog # AAP55100 (Previous Catalog # AAPP32718)

Target Info

• Reference: Yoshinaga,K., (2008) Cancer Sci. 99 (5), 914-919
• Gene Symbol: VASH1
• Gene Full Name: Vasohibin 1
• Alias Symbols: TTCP 1, KIAA1036
• NCBI Gene Id: 22846
• Protein Name: Vasohibin-1
• Description of Target: VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
• Uniprot ID: Q7L8A9
• Protein Accession #: NP_055724
• Nucleotide Accession #: NM_014909
• Protein Size (# AA): 365
• Molecular Weight: 41kDa
• Protein Interactions: DHPS; CCDC23;