Search Antibody, Protein, and ELISA Kit Solutions

VARS2 Antibody - middle region (ARP47652_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47652_P050-FITC Conjugated

ARP47652_P050-HRP Conjugated

ARP47652_P050-Biotin Conjugated

Gene Symbol:
VARS2
Official Gene Full Name:
Valyl-tRNA synthetase 2, mitochondrial (putative)
NCBI Gene Id:
57176
Protein Name:
Valine--tRNA ligase, mitochondrial
Swissprot Id:
Q5ST30
Protein Accession #:
NP_065175
Nucleotide Accession #:
NM_020442
Alias Symbols:
MGC138259, MGC142165, VARS2L, VARSL
Replacement Item:
This antibody may replace item sc-155092 from Santa Cruz Biotechnology.
Description of Target:
The function of the protein remains unknown.
Protein Size (# AA):
1063
Molecular Weight:
118kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VARS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VARS2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human VARS2
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Pig
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Pig: 86%; Rat: 79%
Complete computational species homology data:
Anti-VARS2 (ARP47652_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CMTM5; MAL2; SORBS3; ABI2; NCK2; UBC; PIK3CA; ICT1;
Blocking Peptide:
For anti-VARS2 (ARP47652_P050) antibody is Catalog # AAP47652 (Previous Catalog # AAPP28513)
Datasheets/Manuals:
Printable datasheet for anti-VARS2 (ARP47652_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...