Search Antibody, Protein, and ELISA Kit Solutions

VARS Antibody - middle region (ARP46151_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP46151_P050-FITC Conjugated

ARP46151_P050-HRP Conjugated

ARP46151_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
The immunogen is a synthetic peptide directed towards the middle region of human VARS
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 86%
Complete computational species homology data:
Anti-VARS (ARP46151_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-VARS (ARP46151_P050) antibody is Catalog # AAP46151 (Previous Catalog # AAPS17009)
Printable datasheet for anti-VARS (ARP46151_P050) antibody
Sample Type Confirmation:

VARS is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Duarte, M. & Videira, A. Defective valyl-tRNA synthetase hampers the mitochondrial respiratory chain in Neurospora crassa. Biochem. J. 448, 297-306 (2012). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 22957697

Gene Symbol:
Official Gene Full Name:
Valyl-tRNA synthetase
Alias Symbols:
NCBI Gene Id:
Protein Name:
Valine--tRNA ligase
Description of Target:
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. The protein encoded by this gene belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express VARS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express VARS.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...