VACWR025 Recombinant Protein (VACV) (OPCA03235)

Catalog No: OPCA03235

C3L Recombinant Protein (Vaccinia virus) (OPCA03235) in SDS-PAGE showing the molecular weight of approximately 28.64 kDa.

Product Info

• Predicted Species Reactivity: Vaccinia Virus
• Product Format: Liquid or Lyophilized powder
• Host: Vaccinia virus
• Additional Information: Relevance: Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR
• Protein Sequence: CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 20-263 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Vaccinia virus encodes a secretory polypeptide structurally related to complement control proteins.Kotwal G.J., Moss B.Nature 335:176-178(1988)
• Gene Symbol: C3L
• Gene Full Name: secreted complement-binding protein
• Alias Symbols: 28 kDa protein;secreted complement-binding protein;Secretory protein 35;VACWR025;VCP.
• NCBI Gene Id: 3707640
• Protein Name: Complement control protein C3
• Description of Target: Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b.
• Uniprot ID: P68638
• Protein Accession #: YP_232907.1
  
• Nucleotide Accession #: NC_006998.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 28.6 kDa