UVSY Recombinant Protein (Bacteriophage T4) (OPCA03401)

Catalog No: OPCA03401

uvsY Recombinant Protein (Enterobacteria phage T4) (OPCA03401) in SDS-PAGE showing the molecular weight of approximately 31.83 kDa.

Product Info

• Predicted Species Reactivity: Enterobacteria phage T4|Escherichia phage T4
• Product Format: Liquid or Lyophilized powder
• Host: Enterobacteria phage T4
• Additional Information: Relevance: Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK
• Protein Sequence: MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-137 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Two bacteriophage T4 base plate genes (25 and 26) and the DNA repair gene uvsY belong to spatially and temporally overlapping transcription units.Gruidl M.E., Chen T.C., Gargano S., Storlazzi A., Cascino A., Mosig G.Virology 184:359-369(1991)
• Gene Symbol: uvsY
• Gene Full Name: UvsY recombination, repair and ssDNA binding protein
• Alias Symbols: fdsB;T4p187;UvsY recombination, repair and ssDNA binding protein.
• NCBI Gene Id: 1258547
• Protein Name: Recombination protein uvsY
• Description of Target: Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA.
• Uniprot ID: P04537
• Protein Size (# AA): Recombinant
• Molecular Weight: 31.8 kDa