UTY Antibody - N-terminal region (ARP58214_P050)

Catalog No: ARP58214_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: UTY
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UTY
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LYETQRKYHSAKEAYEQLLQTENLPAQVKATVLQQLGWMHHNMDLVGDKA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UTY (ARP58214_P050) antibody is Catalog # AAP58214

Target Info

• Gene Symbol: UTY
• Gene Full Name: ubiquitously transcribed tetratricopeptide repeat containing, Y-linked
• Alias Symbols: UTY1, KDM6C, KDM6AL
• NCBI Gene Id: 7404
• Protein Name: histone demethylase UTY
• Description of Target: This gene encodes a protein containing tetratricopeptide repeats which are thought to be involved in protein-protein interactions. The encoded protein is also a minor histocompatibility antigen which may induce graft rejection of male stem cell grafts. A large number of alternatively spliced transcripts have been observed for this gene, but the full length nature of some of these variants has not been determined.
• Uniprot ID: O15550
• Protein Accession #: NP_009056
• Nucleotide Accession #: NM_007125.4
• Protein Size (# AA): 1401
• Molecular Weight: 154 kDa
• Protein Interactions: PRDX2; NCOA6; TLE2; TLE1;