USP7 Antibody - middle region (ARP59057_P050)

Catalog No: ARP59057_P050

WB Suggested Anti-USP7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: A549 cell lysate

Host: Rat
Target Name: USP7
Sample Tissue: Rat Brain
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human USP7
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: RVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-USP7 (ARP59057_P050) antibody is Catalog # AAP59057 (Previous Catalog # AAPP45049)
• Publications:

  Nicotine Induced Murine Spermatozoa Apoptosis via Up-Regulation of Deubiquitinated RIP1 by Trim27 Promoter Hypomethylation. Biol. Reprod. 94, 31 (2016). 26607717

Target Info

• Gene Symbol: USP7
• Gene Full Name: Ubiquitin specific peptidase 7 (herpes virus-associated)
• Alias Symbols: TEF1, HAUSP, HAFOUS
• NCBI Gene Id: 7874
• Protein Name: Ubiquitin carboxyl-terminal hydrolase 7
• Description of Target: USP7 is a hydrolase that deubiquitinates target proteins such as FOXO4, TP53, MDM2, PTEN and DAXX. Together with DAXX, USP7 prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards TP53, thereby promoting TP53 ubiquitination and proteasomal degradation. USP7 deubiquitinates TP53 and MDM2 and strongly stabilizes TP53 even in the presence of excess MDM2, and also induces TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, USP7 is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. USP7 is involved in cell proliferation during early embryonic development. USP7 contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 during HSV-1 infection.
• Uniprot ID: Q93009
• Protein Accession #: NP_003461
• Nucleotide Accession #: NM_003470
• Protein Size (# AA): 1102
• Molecular Weight: 128kDa
• Protein Interactions: UBC; TP53; CHFR; RNF220; TPP1; FAM175B; HUWE1; PEPD; XPC; SUMO2; IKBKG; SHFM1; RB1; SUMO1; RPA3; RPA2; RPA1; PTEN; EED; ABL1; RNF2; MMS19; PPP6C; FKBP5; PPP6R3; CDC37; OGFR; COPS6; MAGED2; TRAP1; MCMBP; CLK3; UHRF1; PPARG; RNF11; KAT5; SOX2; LOC576779; HD