Search Antibody, Protein, and ELISA Kit Solutions

USP14 Antibody - C-terminal region (ARP96866_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
NCBI Gene Id:
Protein Name:
ubiquitin carboxyl-terminal hydrolase 14
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Protein Size (# AA):
Molecular Weight:
54 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express USP14.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express USP14.
The immunogen is a synthetic peptide directed towards the C terminal region of human USP14
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: DEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-USP14 (ARP96866_P050) antibody is Catalog # AAP96866
Printable datasheet for anti-USP14 (ARP96866_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...