Search Antibody, Protein, and ELISA Kit Solutions

USH1C Antibody - middle region (ARP79327_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
USH1C
Official Gene Full Name:
Usher syndrome 1C
NCBI Gene Id:
10083
Protein Name:
harmonin
Swissprot Id:
Q9Y6N9
Protein Accession #:
NP_001284693.1
Nucleotide Accession #:
NM_001297764.1
Alias Symbols:
PDZ73, AIE-75, DFNB18, PDZ-45, PDZ-73, PDZD7C, DFNB18A, NY-CO-37, NY-CO-38, ush1cpst, PDZ-73/NY-CO-38
Description of Target:
This gene encodes a scaffold protein that functions in the assembly of Usher protein complexes. The protein contains PDZ domains, a coiled-coil region with a bipartite nuclear localization signal and a PEST degradation sequence. Defects in this gene are the cause of Usher syndrome type 1C and non-syndromic sensorineural deafness autosomal recessive type 18. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
552
Molecular Weight:
60 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express USH1C.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express USH1C.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle terminal region of human USH1C
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: NERYRKEMEQIVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-USH1C (ARP79327_P050) antibody is Catalog # AAP79327
Datasheets/Manuals:
Printable datasheet for anti-USH1C (ARP79327_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...