SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP56288_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

URG4 Antibody - middle region (ARP56288_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-URGCP (ARP56288_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human URG4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Mouse: 86%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR
Concentration0.5 mg/ml
Blocking PeptideFor anti-URGCP (ARP56288_P050) antibody is Catalog # AAP56288 (Previous Catalog # AAPP38307)
ReferenceSong,J., (2006) Neoplasia 8 (12), 995-1002
Gene SymbolURGCP
Gene Full NameUpregulator of cell proliferation
Alias SymbolsURG4
NCBI Gene Id55665
Protein NamecDNA FLJ58708, weakly similar to Mus musculus GTPase, very large interferon inducible 1, transcript variant A, mRNA EMBL BAH13717.1
Description of TargetThe specific function of this protein remains unknown.URG4 is upregulated in the presence of hepatitis B virus (HBV)-encoded X antigen (HBxAg) and may contribute to the development of hepatocellular carcinoma by promoting hepatocellular growth and survival (Tufan et al., 2002 [PubMed 12082552]).[supplied by OMIM].
Uniprot IDQ8TCY9
Protein Accession #NP_001071132
Nucleotide Accession #NM_001077664
Protein Size (# AA)888
Molecular Weight100kDa
Protein InteractionsUBC; VIM; CHMP5;
  1. What is the species homology for "URG4 Antibody - middle region (ARP56288_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "URG4 Antibody - middle region (ARP56288_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "URG4 Antibody - middle region (ARP56288_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "URG4 Antibody - middle region (ARP56288_P050)"?

    This target may also be called "URG4" in publications.

  5. What is the shipping cost for "URG4 Antibody - middle region (ARP56288_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "URG4 Antibody - middle region (ARP56288_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "URG4 Antibody - middle region (ARP56288_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "100kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "URG4 Antibody - middle region (ARP56288_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "URGCP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "URGCP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "URGCP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "URGCP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "URGCP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "URGCP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:URG4 Antibody - middle region (ARP56288_P050)
Your Rating