UQCR10 Recombinant Protein (Human) (OPCA05029)

Catalog No: OPCA05029

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
• Protein Sequence: AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-63 aa
• Tag: N-terminal GST-tagged
• Reference: Ubiquinol-cytochrome-c reductase from human and bovine mitochondria. Schaegger H., Brandt U., Gencic S., von Jagow G. Methods Enzymol. 260:82-96(1995)

Target Info

• Gene Symbol: UQCR10
• Gene Full Name: ubiquinol-cytochrome c reductase, complex III subunit X
• Alias Symbols: Complex III subunit 9;Complex III subunit X;cytochrome b-c1 complex subunit 9;cytochrome c1 non-heme 7 kDa protein;cytochrome C1, nonheme 7kDa protein;HSPC051;HSPC119;HSPC151;QCR9;ubiquinol-cytochrome c reductase complex (7.2 kD);ubiquinol-cytochrome c reductase complex 7.2 kDa protein;ubiquinol-cytochrome c reductase, complex III subunit X, 7.2kDa;UCCR7.2;UCRC.
• NCBI Gene Id: 29796
• Protein Name: Cytochrome b-c1 complex subunit 9
• Description of Target: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1 (By similarity).
• Uniprot ID: Q9UDW1
• Protein Accession #: NP_001003684
• Nucleotide Accession #: NM_001003684
• Protein Size (# AA): Recombinant
• Molecular Weight: 34.2 kDa