UQCC1 Antibody - N-terminal region : FITC (ARP66304_P050-FITC)

Catalog No: ARP66304_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human UQCC
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: RCQMPDTFNSWFLITLLHVWMCLVRMKQEGRSGKYMCRIIVHFMWEDVQQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UQCC1 (ARP66304_P050-FITC) antibody is Catalog # AAP66304

Target Info

• Gene Symbol: UQCC1
• Gene Full Name: ubiquinol-cytochrome c reductase complex assembly factor 1
• Alias Symbols: BFZB, CBP3, UQCC, C20orf44
• NCBI Gene Id: 55245
• Protein Name: ubiquinol-cytochrome-c reductase complex assembly factor 1
• Description of Target: This gene encodes a transmembrane protein that is structurally similar to the mouse basic fibroblast growth factor repressed ZIC-binding protein. In mouse this protein may be involved in fibroblast growth factor regulated growth control. In humans, polymorphisms in this gene are associated with variation in human height and osteoarthritis. Alternate splicing results in multiple transcript variants.
• Uniprot ID: B1AKV5
• Protein Accession #: NP_001171906
• Nucleotide Accession #: NM_001184977
• Protein Size (# AA): 231
• Molecular Weight: 27kDa
• Protein Interactions: UQCC2; BRCA2; SETD1B; SETD1A;