SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP40998_T100-FITC
Size:100ul
Price: $384.00
SKU
ARP40998_T100-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

UPF3B Antibody - N-terminal region : FITC (ARP40998_T100-FITC)

Datasheets/ManualsPrintable datasheet for anti-UPF3B (ARP40998_T100-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human UPF3B
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEAL
Concentration0.5 mg/ml
Blocking PeptideFor anti-UPF3B (ARP40998_T100-FITC) antibody is Catalog # AAP40998 (Previous Catalog # AAPP22424)
ReferenceLehner,B. (2004) Genome Res. 14 (7), 1315-1323
Gene SymbolUPF3B
Gene Full NameUPF3 regulator of nonsense transcripts homolog B (yeast)
Alias SymbolsMRX62, MRX82, UPF3X, HUPF3B, MRXS14, RENT3B, UPF3BP1, UPF3BP2, UPF3BP3, Upf3p-X
NCBI Gene Id65109
Protein NameRegulator of nonsense transcripts 3B
Description of TargetUPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctionsThis gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene.
Uniprot IDQ9BZI7
Protein Accession #NP_075386
Nucleotide Accession #NM_023010
Protein Size (# AA)470
Molecular Weight52kDa
Protein InteractionsNCBP1; CIAO1; STAU1; UBC; UPF1; HECW2; RBM8A; UPF2; SMG1; EIF4A3; WIBG; WBP11; RNPS1; SART1; TOP2A; SNRPA1; NXF1; CAND1; COPS5; CUL5; USP21; EXOSC4; MCRS1; XRN1; TTC19; EIF6; UPF3B; HBB; UPF3A;
  1. What is the species homology for "UPF3B Antibody - N-terminal region : FITC (ARP40998_T100-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Pig, Rabbit".

  2. How long will it take to receive "UPF3B Antibody - N-terminal region : FITC (ARP40998_T100-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "UPF3B Antibody - N-terminal region : FITC (ARP40998_T100-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "UPF3B Antibody - N-terminal region : FITC (ARP40998_T100-FITC)"?

    This target may also be called "MRX62, MRX82, UPF3X, HUPF3B, MRXS14, RENT3B, UPF3BP1, UPF3BP2, UPF3BP3, Upf3p-X" in publications.

  5. What is the shipping cost for "UPF3B Antibody - N-terminal region : FITC (ARP40998_T100-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "UPF3B Antibody - N-terminal region : FITC (ARP40998_T100-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "UPF3B Antibody - N-terminal region : FITC (ARP40998_T100-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "UPF3B Antibody - N-terminal region : FITC (ARP40998_T100-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "UPF3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "UPF3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "UPF3B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "UPF3B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "UPF3B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "UPF3B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:UPF3B Antibody - N-terminal region : FITC (ARP40998_T100-FITC)
Your Rating
We found other products you might like!