UOX Recombinant Protein (Pig) (OPCA04299)

Catalog No: OPCA04299

Product Info

• Predicted Species Reactivity: Porcine|Sus scrofa
• Product Format: Lyophilized 20mM Tris-HCl, 0.5M NaCl, 6% Trehalose
• Additional Information: Species Specificity Detail: Sus scrofa (Pig)
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: Full Length: MAHYRNDYKKNDEVEFVRTGYGKDMIKVLHIQRDGKYHSIKEVATSVQLTLSSKKDYLHGDNSDVIPTDTIKNTVNVLAKFKGIKSIETFAVTICEHFLSSFKHVIRAQVYVEEVPWKRFEKNGVKHVHAFIYTPTGTHFCEVEQIRNGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKDRCFATQVYCKWRYHQGRDVDFEATWDTVRSIVLQKFAGPYDKGEYSPSVQKTLYDIQVLTLGQVPEIEDMEISLPNIHYLNIDMSKMGLINKEEVLLPLDNPYGRITGTVKRKLTSRL
• Source: E.coli
• Protein Range: 1-304 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Generation of cDNA probes directed by amino acid sequence: cloning of urate oxidase.Lee C.C., Wu X., Gibbs R.A., Cook R.G., Muzny D.M., Caskey C.T.Science 239:1288-1291(1988)
• Gene Symbol: UOX
• Gene Full Name: urate oxidase
• Alias Symbols: Urate oxidase;uricase.
• NCBI Gene Id: 397510
• Protein Name: Uricase
• Description of Target: Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S)-allantoin.
• Uniprot ID: P16164
• Protein Size (# AA): Recombinant
• Molecular Weight: 51 kDa