UNG Antibody - C-terminal region : Biotin (ARP61205_P050-Biotin)

Catalog No: ARP61205_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Yeast: 79%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: GWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UNG (ARP61205_P050-Biotin) antibody is Catalog # AAP61205 (Previous Catalog # AAPP47357)
• Sample Type Confirmation:

  UNG is supported by BioGPS gene expression data to be expressed in HeLa

Target Info

• Gene Symbol: UNG
• Gene Full Name: Uracil-DNA glycosylase
• Alias Symbols: DGU, UDG, UNG1, UNG2, HIGM4, HIGM5, UNG15
• NCBI Gene Id: 7374
• Protein Name: Uracil-DNA glycosylase
• Description of Target: This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases.
• Uniprot ID: P13051
• Protein Accession #: NP_550433
• Nucleotide Accession #: NM_080911
• Protein Size (# AA): 313
• Molecular Weight: 34kDa
• Protein Interactions: RPA3; RPA2; RPA1; vpr; SEZ6L2; CAPN11; UBC; SMUG1; UBE2E2; THOP1; APP; POLB; HSPB1; VPRBP; DDB1; PCNA; PPM1D;