Search Antibody, Protein, and ELISA Kit Solutions

UNG antibody - C-terminal region (ARP61205_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61205_P050-FITC Conjugated

ARP61205_P050-HRP Conjugated

ARP61205_P050-Biotin Conjugated

Gene Symbol:
UNG
NCBI Gene Id:
7374
Official Gene Full Name:
Uracil-DNA glycosylase
Protein Name:
Uracil-DNA glycosylase
Swissprot Id:
P13051
Protein Accession #:
NP_550433
Nucleotide Accession #:
NM_080911
Alias Symbols:
DGU, DKFZp781L1143, HIGM4, UDG, UNG1, UNG15, UNG2
Replacement Item:
This antibody may replace item sc-116418 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases.
Protein Size (# AA):
313
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UNG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UNG.
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Yeast: 79%; Zebrafish: 79%
Complete computational species homology data:
Anti-UNG (ARP61205_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RPA3; RPA2; RPA1; vpr; SEZ6L2; CAPN11; UBC; SMUG1; UBE2E2; THOP1; APP; POLB; HSPB1; VPRBP; DDB1; PCNA; PPM1D;
Blocking Peptide:
For anti-UNG (ARP61205_P050) antibody is Catalog # AAP61205 (Previous Catalog # AAPP47357)
Datasheets/Manuals:
Printable datasheet for anti-UNG (ARP61205_P050) antibody
Sample Type Confirmation:

UNG is supported by BioGPS gene expression data to be expressed in HeLa

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...