Search Antibody, Protein, and ELISA Kit Solutions

UNC5C Antibody - C-terminal region (ARP45510_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45510_P050-FITC Conjugated

ARP45510_P050-HRP Conjugated

ARP45510_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
UNC5C
Official Gene Full Name:
Unc-5 homolog C (C. elegans)
NCBI Gene Id:
8633
Protein Name:
Netrin receptor UNC5C
Swissprot Id:
O95185
Protein Accession #:
NP_003719
Nucleotide Accession #:
NM_003728
Alias Symbols:
UNC5H3
Description of Target:
UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
Protein Size (# AA):
931
Molecular Weight:
103kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UNC5C.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UNC5C.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human UNC5C
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-UNC5C (ARP45510_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
DAP; NPM1; NTN1; DAPK1;
Blocking Peptide:
For anti-UNC5C (ARP45510_P050) antibody is Catalog # AAP45510 (Previous Catalog # AAPP26572)
Datasheets/Manuals:
Printable datasheet for anti-UNC5C (ARP45510_P050) antibody
Target Reference:
Shin,S.K., (2007) Gastroenterology 133 (6), 1849-1857

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...