Search Antibody, Protein, and ELISA Kit Solutions

UNC5A antibody - middle region : FITC (ARP50294_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP50294_P050 Unconjugated

ARP50294_P050-HRP Conjugated

ARP50294_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Unc-5 homolog A (C. elegans)
Protein Name:
Netrin receptor UNC5A
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ16449, KIAA1976, UNC5H1
Replacement Item:
This antibody may replace item sc-67905 from Santa Cruz Biotechnology.
Description of Target:
UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C.UNC5A belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UNC5A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UNC5A.
The immunogen is a synthetic peptide directed towards the middle region of human UNC5A
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-UNC5A (ARP50294_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-UNC5A (ARP50294_P050-FITC) antibody is Catalog # AAP50294 (Previous Catalog # AAPY03371)
Printable datasheet for anti-UNC5A (ARP50294_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Souchet,M., (2004) Nat. Rev. Cancer 4 (12), 978-987

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...