Search Antibody, Protein, and ELISA Kit Solutions

UNC5A antibody - middle region (ARP50294_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP50294_P050-FITC Conjugated

ARP50294_P050-HRP Conjugated

ARP50294_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Unc-5 homolog A (C. elegans)
Protein Name:
Netrin receptor UNC5A
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ16449, KIAA1976, UNC5H1
Replacement Item:
This antibody may replace item sc-67905 from Santa Cruz Biotechnology.
Description of Target:
UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C.UNC5A belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UNC5A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UNC5A.
The immunogen is a synthetic peptide directed towards the middle region of human UNC5A
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-UNC5A (ARP50294_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-UNC5A (ARP50294_P050) antibody is Catalog # AAP50294 (Previous Catalog # AAPY03371)
Printable datasheet for anti-UNC5A (ARP50294_P050) antibody
Target Reference:
Souchet,M., (2004) Nat. Rev. Cancer 4 (12), 978-987

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...