Search Antibody, Protein, and ELISA Kit Solutions

UMPS Antibody - C-terminal region (ARP48147_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP48147_P050-FITC Conjugated

ARP48147_P050-HRP Conjugated

ARP48147_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-124467 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human UMPS
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Yeast: 75%
Complete computational species homology data:
Anti-UMPS (ARP48147_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-UMPS (ARP48147_P050) antibody is Catalog # AAP48147 (Previous Catalog # AAPP13022)
Datasheets/Manuals:
Printable datasheet for anti-UMPS (ARP48147_P050) antibody
Sample Type Confirmation:

UMPS is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Sakamoto,E., (2007) Biochem. Biophys. Res. Commun. 363 (1), 216-222
Gene Symbol:
UMPS
Official Gene Full Name:
Uridine monophosphate synthetase
Alias Symbols:
OPRT
NCBI Gene Id:
7372
Protein Name:
Uridine 5'-monophosphate synthase
Description of Target:
OPRT (UMPS) is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas. Orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma. Determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy.
Swissprot Id:
P11172
Protein Accession #:
NP_000364
Nucleotide Accession #:
NM_000373
Protein Size (# AA):
480
Molecular Weight:
52kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UMPS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UMPS.
Protein Interactions:
UBC; CALU; PLA2G12A; ZNF227; RPS29; PAXIP1; PSEN1; NOS3; APRT; A2M; CUL3; USP50; CDC42EP3; DLST;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...