Search Antibody, Protein, and ELISA Kit Solutions

UMPS Antibody - C-terminal region (ARP48147_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48147_P050-FITC Conjugated

ARP48147_P050-HRP Conjugated

ARP48147_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Uridine monophosphate synthetase
NCBI Gene Id:
Protein Name:
Uridine 5'-monophosphate synthase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-124467 from Santa Cruz Biotechnology.
Description of Target:
OPRT (UMPS) is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas. Orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma. Determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UMPS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UMPS.
The immunogen is a synthetic peptide directed towards the C terminal region of human UMPS
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Yeast: 75%
Complete computational species homology data:
Anti-UMPS (ARP48147_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-UMPS (ARP48147_P050) antibody is Catalog # AAP48147 (Previous Catalog # AAPP13022)
Printable datasheet for anti-UMPS (ARP48147_P050) antibody
Sample Type Confirmation:

UMPS is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Sakamoto,E., (2007) Biochem. Biophys. Res. Commun. 363 (1), 216-222

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...