UGT1A9 Antibody - N-terminal region (ARP42579_P050)

Catalog No: ARP42579_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-UGT1A9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A9
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 100%; Sheep: 83%
• Peptide Sequence: Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UGT1A9 (ARP42579_P050) antibody is Catalog # AAP42579 (Previous Catalog # AAPP24815)
• Reference: Han,J.Y., (er) Lung Cancer (2008) In press

Target Info

• Gene Symbol: UGT1A9
• Gene Full Name: UDP glucuronosyltransferase 1 family, polypeptide A9
• Alias Symbols: LUGP4, UDPGT, UGT1I, HLUGP4, UGT-1I, UGT1-9, UGT1.9, UGT1AI, UGT1-09, UGT1A9S, UDPGT 1-9
• NCBI Gene Id: 54600
• Protein Name: UDP-glucuronosyltransferase 1-9
• Description of Target: UGT1A9 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. UGT1A9 is active on phenols.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenols. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: O60656
• Protein Accession #: NP_066307
• Nucleotide Accession #: NM_021027
• Protein Size (# AA): 530
• Molecular Weight: 57kDa