Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP41458_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41458_P050-FITC Conjugated

ARP41458_P050-HRP Conjugated

ARP41458_P050-Biotin Conjugated

UGT1A6 Antibody - C-terminal region (ARP41458_P050)

Catalog#: ARP41458_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-27431 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human UGT1A6
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
Complete computational species homology data Anti-UGT1A6 (ARP41458_P050)
Peptide Sequence Synthetic peptide located within the following region: APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-UGT1A6 (ARP41458_P050) antibody is Catalog # AAP41458 (Previous Catalog # AAPS09204)
Datasheets/Manuals Printable datasheet for anti-UGT1A6 (ARP41458_P050) antibody
Target Reference Berkhout,M., (2008) Br J Surg 95 (4), 499-505
Gene Symbol UGT1A6
Official Gene Full Name UDP glucuronosyltransferase 1 family, polypeptide A6
Alias Symbols GNT1, HLUGP, HLUGP1, MGC29860, UDPGT, UGT1, UGT1F, UGT1A6S, UDPGT 1-6
NCBI Gene Id 54578
Protein Name UDP-glucuronosyltransferase 1-6
Description of Target UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.
Swissprot Id P19224
Protein Accession # NP_001063
Nucleotide Accession # NM_001072
Protein Size (# AA) 532
Molecular Weight 58kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express UGT1A6.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express UGT1A6.
  1. What is the species homology for "UGT1A6 Antibody - C-terminal region (ARP41458_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish".

  2. How long will it take to receive "UGT1A6 Antibody - C-terminal region (ARP41458_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "UGT1A6 Antibody - C-terminal region (ARP41458_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "UGT1A6 Antibody - C-terminal region (ARP41458_P050)"?

    This target may also be called "GNT1, HLUGP, HLUGP1, MGC29860, UDPGT, UGT1, UGT1F, UGT1A6S, UDPGT 1-6" in publications.

  5. What is the shipping cost for "UGT1A6 Antibody - C-terminal region (ARP41458_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "UGT1A6 Antibody - C-terminal region (ARP41458_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "UGT1A6 Antibody - C-terminal region (ARP41458_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "UGT1A6 Antibody - C-terminal region (ARP41458_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "UGT1A6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "UGT1A6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "UGT1A6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "UGT1A6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "UGT1A6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "UGT1A6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:UGT1A6 Antibody - C-terminal region (ARP41458_P050)
Your Rating
We found other products you might like!