Now Offering Over 102,157 Antibodies & 44,722 Antigens!

UGT1A6 antibody - C-terminal region (ARP41458_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP41458_P050-FITC Conjugated

ARP41458_P050-HRP Conjugated

ARP41458_P050-Biotin Conjugated

Gene Symbol:
UGT1A6
NCBI Gene Id:
54578
Official Gene Full Name:
UDP glucuronosyltransferase 1 family, polypeptide A6
Protein Name:
UDP-glucuronosyltransferase 1-6
Swissprot Id:
P19224
Protein Accession #:
NP_001063
Nucleotide Accession #:
NM_001072
Alias Symbols:
GNT1, HLUGP, HLUGP1, MGC29860, UDPGT, UGT1, UGT1F, UGT1A6S, UDPGT 1-6
Replacement Item:
This antibody may replace item sc-27431 from Santa Cruz Biotechnology.
Description of Target:
UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.
Protein Size (# AA):
532
Molecular Weight:
58kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UGT1A6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UGT1A6.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human UGT1A6
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
Complete computational species homology data:
Anti-UGT1A6 (ARP41458_P050)
Peptide Sequence:
Synthetic peptide located within the following region: APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-UGT1A6 (ARP41458_P050) antibody is Catalog # AAP41458 (Previous Catalog # AAPS09204)
Datasheets/Manuals:
Printable datasheet for anti-UGT1A6 (ARP41458_P050) antibody
Target Reference:
Berkhout,M., (2008) Br J Surg 95 (4), 499-505

Tell us what you think about this item!

Write A Review
    Please, wait...