UEVLD Antibody - middle region (ARP57194_P050)

Catalog No: ARP57194_P050

WB Suggested Anti-UEVLD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysateUEVLD is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UEVLD
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 85%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 91%; Pig: 92%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: SLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UEVLD (ARP57194_P050) antibody is Catalog # AAP57194 (Previous Catalog # AAPP40843)
• Sample Type Confirmation:

  UEVLD is supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Gene Symbol: UEVLD
• Gene Full Name: UEV and lactate/malate dehyrogenase domains
• Alias Symbols: ATTP, UEV3
• NCBI Gene Id: 55293
• Protein Name: Ubiquitin-conjugating enzyme E2 variant 3 Ensembl ENSP00000379499
• Description of Target: UEVLD is a possible negative regulator of polyubiquitination.
• Uniprot ID: A8MYV4
• Protein Accession #: NP_060784
• Nucleotide Accession #: NM_018314
• Protein Size (# AA): 379
• Molecular Weight: 42kDa
• Protein Interactions: UBC; DTX3; LRSAM1; RNF114; TRAF6; RNF4;