Now Offering Over 102,157 Antibodies & 44,722 Antigens!

UCRC antibody - middle region (ARP44448_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock

Conjugation Options

ARP44448_P050-FITC Conjugated

ARP44448_P050-HRP Conjugated

ARP44448_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
UQCR10
NCBI Gene Id:
29796
Official Gene Full Name:
Ubiquinol-cytochrome c reductase, complex III subunit X
Protein Name:
Cytochrome b-c1 complex subunit 9
Swissprot Id:
Q9UDW1
Protein Accession #:
NP_037519
Nucleotide Accession #:
NM_013387
Alias Symbols:
HSPC051, HSPC119, HSPC151, QCR9, UCRC, UCCR7.2
Description of Target:
UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).[supplied by OMIM].
Protein Size (# AA):
63
Molecular Weight:
7kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UCRC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UCRC.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human UCRC
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-UCRC (ARP44448_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CYSTM1; RAB11A; HNRNPM; MOV10; UBC; UQCR11; UQCRFS1; UQCRC1;
Blocking Peptide:
For anti-UQCR10 (ARP44448_P050) antibody is Catalog # AAP44448 (Previous Catalog # AAPP25758)
Datasheets/Manuals:
Printable datasheet for anti-UQCR10 (ARP44448_P050) antibody
Sample Type Confirmation:

UQCR10 is supported by BioGPS gene expression data to be expressed in MCF7

Subunit:
9
Target Reference:
Guzy,R.D., (2005) Cell Metab. 1 (6), 401-408

Tell us what you think about this item!

Write A Review
    Please, wait...