UCP3 Antibody - middle region (ARP80687_P050)

Catalog No: ARP80687_P050

Host: Rabbit
Target Name: UCP3
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UCP3
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: CTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UCP3 (ARP80687_P050) antibody is Catalog # AAP80687

Target Info

• Gene Symbol: UCP3
• Gene Full Name: uncoupling protein 3 (mitochondrial, proton carrier)
• Alias Symbols: SLC25A9
• NCBI Gene Id: 7352
• Protein Name: mitochondrial uncoupling protein 3
• Description of Target: Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. The different UCPs have tissue-specific expression; this gene is primarily expressed in skeletal muscle. This gene's protein product is postulated to protect mitochondria against lipid-induced oxidative stress. Expression levels of this gene increase when fatty acid supplies to mitochondria exceed their oxidation capacity and the protein enables the export of fatty acids from mitochondria. UCPs contain the three solcar protein domains typically found in MACPs. Two splice variants have been found for this gene.
• Uniprot ID: P55916-2
• Protein Accession #: NP_003347.1
• Nucleotide Accession #: NM_003356.3
• Protein Size (# AA): 275
• Molecular Weight: 30 kDa