Search Antibody, Protein, and ELISA Kit Solutions

UBXN1 Antibody - N-terminal region : FITC (ARP75560_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75560_P050 Unconjugated

ARP75560_P050-HRP Conjugated

ARP75560_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
Description of Target:
UBXN1 is a ubiquitin-binding protein that interacts with the BRCA1- BARD1 heterodimer, and regulates its activity. It specifically binds 'Lys-6'-linked polyubiquitin chains. Interaction with autoubiquitinated BRCA1,it leads to inhibit the E3 ubiquitin-protein ligase activity of the BRCA1-BARD1 heterodimer. It is a component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UBXN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UBXN1.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human UBXN1
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: GRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-UBXN1 (ARP75560_P050-FITC) antibody is Catalog # AAP75560
Printable datasheet for anti-UBXN1 (ARP75560_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...