Search Antibody, Protein, and ELISA Kit Solutions

UBXN1 Antibody - N-terminal region : FITC (ARP75560_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75560_P050 Unconjugated

ARP75560_P050-HRP Conjugated

ARP75560_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
UBXN1
NCBI Gene Id:
51035
Swissprot Id:
Q04323
Alias Symbols:
UBXN1, SAKS1,
Description of Target:
UBXN1 is a ubiquitin-binding protein that interacts with the BRCA1- BARD1 heterodimer, and regulates its activity. It specifically binds 'Lys-6'-linked polyubiquitin chains. Interaction with autoubiquitinated BRCA1,it leads to inhibit the E3 ubiquitin-protein ligase activity of the BRCA1-BARD1 heterodimer. It is a component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol.
Protein Size (# AA):
297
Molecular Weight:
32kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UBXN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UBXN1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human UBXN1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: GRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
UBXN1; UBQLN1; FAM189A2; PLAA; TRIM39; VCP; UBE2I; UBC; PLA2G4A; MAVS; NSFL1C; STK26; TRNT1; MCTS1; TWF2; PROSC; BASP1; DENR; YWHAE; TXNRD1; TUFM; TUBB2A; PAFAH1B1; HSPA5; HMGB3; HK1; CTPS1; CAPN2; CD81; CSE1L; CLNS1A; ATP6V1A; SSSCA1; USP34; SEC22B; VPS4
Blocking Peptide:
For anti-UBXN1 (ARP75560_P050-FITC) antibody is Catalog # AAP75560
Datasheets/Manuals:
Printable datasheet for anti-UBXN1 (ARP75560_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...