- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for UBR1 Antibody (OAAL00954) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 4G7 |
| Isotype | IgG2b Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | UBR1 (NP_777576, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | UBR1 |
|---|---|
| Gene Full Name | ubiquitin protein ligase E3 component n-recognin 1 |
| Alias Symbols | E3 ubiquitin-protein ligase UBR1;E3a ligase;JBS;N-recognin-1;RING-type E3 ubiquitin transferase UBR1;ubiquitin ligase E3 alpha-I;ubiquitin-protein ligase E3-alpha;ubiquitin-protein ligase E3-alpha-1;ubiquitin-protein ligase E3-alpha-I. |
| NCBI Gene Id | 197131 |
| Protein Name | E3 ubiquitin-protein ligase UBR1 [Homo sapiens] |
| Description of Target | The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_777576 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "UBR1 Antibody (OAAL00954)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "UBR1 Antibody (OAAL00954)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "UBR1 Antibody (OAAL00954)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "UBR1 Antibody (OAAL00954)"?
This target may also be called "E3 ubiquitin-protein ligase UBR1;E3a ligase;JBS;N-recognin-1;RING-type E3 ubiquitin transferase UBR1;ubiquitin ligase E3 alpha-I;ubiquitin-protein ligase E3-alpha;ubiquitin-protein ligase E3-alpha-1;ubiquitin-protein ligase E3-alpha-I." in publications.
-
What is the shipping cost for "UBR1 Antibody (OAAL00954)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "UBR1 Antibody (OAAL00954)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "UBR1 Antibody (OAAL00954)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "UBR1 Antibody (OAAL00954)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "UBR1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "UBR1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "UBR1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "UBR1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "UBR1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "UBR1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
