Search Antibody, Protein, and ELISA Kit Solutions

UBQLN4 Antibody - middle region (ARP57355_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP57355_P050-FITC Conjugated

ARP57355_P050-HRP Conjugated

ARP57355_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-117148 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human UBQLN4
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 90%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 92%
Complete computational species homology data:
Anti-UBQLN4 (ARP57355_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-UBQLN4 (ARP57355_P050) antibody is Catalog # AAP57355 (Previous Catalog # AAPP41234)
Printable datasheet for anti-UBQLN4 (ARP57355_P050) antibody
Sample Type Confirmation:

UBQLN4 is supported by BioGPS gene expression data to be expressed in HT1080

Gene Symbol:
Official Gene Full Name:
Ubiquilin 4
Alias Symbols:
A1U, C1orf6, UBIN, CIP75
NCBI Gene Id:
Protein Name:
Description of Target:
The function of this protein remains unknown.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UBQLN4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UBQLN4.
Protein Interactions:

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

122/05/2019 22:59
  • Overall Experience:
  • Quality:
GFP Transfected HeLa cells in WB

Submitted by:
Mervyn Monteiro


Sample type: GFP Transfected HeLa cells

Lane description: 30ug HeLa cell lysate

Primary antibody dilution: 1:500, overnight (~20 hr).

Secondary antibody and dilution: 1:2000 (2 hr)

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...