Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

UBQLN1 antibody - middle region (ARP54958_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock

Conjugation Options

ARP54958_P050-FITC Conjugated

ARP54958_P050-HRP Conjugated

ARP54958_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Ubiquilin 1
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DA41, DSK2, FLJ90054, PLIC-1, XDRP1, UBQN
Description of Target:
UBQLN1 is an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and it is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene.This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express UBQLN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express UBQLN1.
The immunogen is a synthetic peptide directed towards the middle region of human UBQLN1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-UBQLN1 (ARP54958_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-UBQLN1 (ARP54958_P050) antibody is Catalog # AAP54958 (Previous Catalog # AAPP32119)
Printable datasheet for anti-UBQLN1 (ARP54958_P050) antibody
Additional Information:
IHC Information: Human Lung, Respiratory Epithelium (formalin-fixed, paraffin-embedded) stained with UBQLN1 antibody ARP54958_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Target Reference:
Zhang,D., (2008) J. Mol. Biol. 377 (1), 162-180

Tell us what you think about this item!

Write A Review
    Please, wait...