UBL7 Antibody - N-terminal region (ARP59394_P050)

Catalog No: ARP59394_P050

WB Suggested Anti-UBL7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UBL7
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: LQESVPDPELIDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UBL7 (ARP59394_P050) antibody is Catalog # AAP59394 (Previous Catalog # AAPP45485)

Target Info

• Gene Symbol: UBL7
• Gene Full Name: Ubiquitin-like 7 (bone marrow stromal cell-derived)
• Alias Symbols: TCBA1, BMSC-UbP
• NCBI Gene Id: 84993
• Protein Name: Ubiquitin-like protein 7
• Description of Target: The function of UBL7 remians unknown.
• Uniprot ID: Q96S82
• Protein Accession #: NP_116296
• Nucleotide Accession #: NM_032907
• Protein Size (# AA): 380
• Molecular Weight: 40kDa
• Protein Interactions: CAPN7; VBP1; ERCC1; AP1G1; UBE4B; UBC; CD4; TTC9C; PPP1R14C; VPS29; UBQLN1; UBQLN2; TWF2; AHCYL1; SSSCA1; USP34; ZRANB2; ZPR1; PIR; USP9X; ZYX; UCHL3; UBE2D1; PSME1; PPM1B; RAD23A; BAG6;