Catalog No: ARP54552_P050
Price: $0.00
SKU
ARP54552_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

UBE4B Antibody - N-terminal region (ARP54552_P050)

Datasheets/ManualsPrintable datasheet for anti-UBE4B (ARP54552_P050) antibody
Product Info
ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human UBE4B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Human: 100%; Pig: 79%
Peptide SequenceSynthetic peptide located within the following region: SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL
Concentration0.5 mg/ml
Blocking PeptideFor anti-UBE4B (ARP54552_P050) antibody is Catalog # AAP54552 (Previous Catalog # AAPP31336)
Gene SymbolUBE4B
Gene Full NameUbiquitination factor E4B
Alias SymbolsE4, UFD2, HDNB1, UBOX3, UFD2A
NCBI Gene Id10277
Protein NameUbiquitin conjugation factor E4 B
Description of TargetThe modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Uniprot IDO95155
Protein Accession #NP_001099032
Nucleotide Accession #NM_001105562
Protein Size (# AA)1302
Molecular Weight146kDa
Protein InteractionsTRIP12; UBC; FBXW11; HGS; STAM; TP53; MDM2; NUSAP1; NUDCD3; RBM12; PDE3A; CDKN2A; UBL7; UBE2D3; CDC27; TTK; IGBP1; HDLBP; TTC9C; MRPL53; ZFYVE19; SARNP; SRPRB; VPS35; UBA6; VPS29; UFM1; SBDS; VPS36; UBQLN1; UBXN7; UBE2C; AHCYL1; SSSCA1; SF3B4; PPIF; SCO2;
  1. What is the species homology for "UBE4B Antibody - N-terminal region (ARP54552_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog, Pig".

  2. How long will it take to receive "UBE4B Antibody - N-terminal region (ARP54552_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "UBE4B Antibody - N-terminal region (ARP54552_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "UBE4B Antibody - N-terminal region (ARP54552_P050)"?

    This target may also be called "E4, UFD2, HDNB1, UBOX3, UFD2A" in publications.

  5. What is the shipping cost for "UBE4B Antibody - N-terminal region (ARP54552_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "UBE4B Antibody - N-terminal region (ARP54552_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "UBE4B Antibody - N-terminal region (ARP54552_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "146kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "UBE4B Antibody - N-terminal region (ARP54552_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "UBE4B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "UBE4B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "UBE4B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "UBE4B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "UBE4B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "UBE4B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:UBE4B Antibody - N-terminal region (ARP54552_P050)
Your Rating