UBE4A Antibody - C-terminal region (ARP82720_P050)

Catalog No: ARP82720_P050

Host: Rabbit
Target Name: UBE4A
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human UBE4A
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LAYARQASSQECIDVLLQYGCPDERFVLMATPNLSRRNNNRNNSSGRVPT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UBE4A (ARP82720_P050) antibody is Catalog # AAP82720

Target Info

• Gene Symbol: UBE4A
• Gene Full Name: UBE4A
• Alias Symbols: E4, UFD2, UBOX2
• NCBI Gene Id: 9354
• Protein Name: ubiquitin conjugation factor E4 A
• Description of Target: This gene encodes a member of the U-box ubiquitin ligase family. The encoded protein is involved in multiubiquitin chain assembly and plays a critical role in chromosome condensation and separation through the polyubiquitination of securin. Autoantibodies against the encoded protein may be markers for scleroderma and Crohn's disease. A pseudogene of this gene is located on the long arm of chromosome 3. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Uniprot ID: Q14139
• Protein Accession #: NP_001191006.1
• Nucleotide Accession #: NM_001204077.1
• Protein Size (# AA): 117
• Molecular Weight: 1066