- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-UBE2Z (OAAN02183) |
---|
Predicted Species Reactivity | Human, Mouse, Rat |
---|---|
Product Format | Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3) |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB, IHC, IF |
Additional Information | Positive Samples: BT-474, MCF7, HepG2, HeLa, mouse pancreas, mouse testis Cellular Location: Cytoplasm, nucleus |
Reconstitution and Storage | Store at -20°C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 115-354 of human UBE2Z (NP_075567.2). |
Purification | Affinity purified against immunogen |
Application Info | WB: 1:500~2000 IHC: 1:50~200 IF: 1:50~100 |
Protein Sequence | PPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV |
Gene Symbol | UBE2Z |
---|---|
Gene Full Name | ubiquitin conjugating enzyme E2 Z |
Alias Symbols | USE1, HOYS7 |
NCBI Gene Id | 65264 |
Protein Name | Ubiquitin-conjugating enzyme E2 Z |
Description of Target | This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis. |
Uniprot ID | Q9H832 |
Protein Accession # | NP_075567.2 |
Nucleotide Accession # | NM_023079.4 |
Molecular Weight | 38 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "UBE2Z Antibody (OAAN02183)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".
-
How long will it take to receive "UBE2Z Antibody (OAAN02183)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "UBE2Z Antibody (OAAN02183)" provided in?
This item is provided in "Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "UBE2Z Antibody (OAAN02183)"?
This target may also be called "USE1, HOYS7" in publications.
-
What is the shipping cost for "UBE2Z Antibody (OAAN02183)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "UBE2Z Antibody (OAAN02183)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "UBE2Z Antibody (OAAN02183)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "38 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "UBE2Z Antibody (OAAN02183)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "UBE2Z"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "UBE2Z"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "UBE2Z"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "UBE2Z"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "UBE2Z"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "UBE2Z"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.