UBE2V2 Recombinant Protein (Human) (OPCA03977)

Catalog No: OPCA03977

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
• Protein Sequence: AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 2-145 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.David Y., Ziv T., Admon A., Navon A.J. Biol. Chem. 285:8595-8604(2010)

Target Info

• Gene Symbol: UBE2V2
• Gene Full Name: ubiquitin conjugating enzyme E2 V2
• Alias Symbols: 1 alpha,25-dihydroxyvitamin D3-inducible;DDVit 1;DDVit-1;DDVIT1;EDAF-1;EDPF1;EDPF-1;enterocyte differentiation promoting factor;enterocyte differentiation-associated factor 1;enterocyte differentiation-associated factor EDAF-1;enterocyte differentiation-promoting factor 1;methyl methanesulfonate sensitive 2, S. cerevisiae, homolog of;MMS2;MMS2 homolog;ubiquitin-conjugating enzyme E2 variant 2;UEV2;UEV-2;vitamin D3-inducible protein.
• NCBI Gene Id: 7336
• Protein Name: Ubiquitin-conjugating enzyme E2 variant 2
• Description of Target: Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
• Uniprot ID: Q15819
• Protein Accession #: NP_003341
• Nucleotide Accession #: NM_003350
• Protein Size (# AA): Recombinant
• Molecular Weight: 32.2 kDa