SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP64751_P050
Price: $0.00
SKU
ARP64751_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-UBE2V2 (ARP64751_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: NFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENR
Concentration0.5 mg/ml
Blocking PeptideFor anti-UBE2V2 (ARP64751_P050) antibody is Catalog # AAP64751
Sample Type Confirmation

UBE2V2 is supported by BioGPS gene expression data to be expressed in 721_B

Gene SymbolUBE2V2
Gene Full NameUbiquitin-conjugating enzyme E2 variant 2
Alias SymbolsMMS2, UEV2, EDPF1, UEV-2, DDVIT1, EDAF-1, EDPF-1, DDVit-1
NCBI Gene Id7336
Protein NameUbiquitin-conjugating enzyme E2 variant 2
Description of TargetUbiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes.
Uniprot IDQ15819
Protein Accession #NP_003341
Nucleotide Accession #NM_003350
Protein Size (# AA)145
Molecular Weight16kDa
Protein Interactionsube2nb; UBC; BCL10; UBE2N; MALT1; RNF11; ZFYVE19; UFM1; UBXN1; UBXN7; TTLL12; CPLX1; SSSCA1; SEC23A; CD2BP2; STUB1; USP34; VPS26A; ZRANB2; ZPR1; USP9X; ZYX; UBE2V1; UBE2L3; UBE2B; RPS21; RAD23B; ATP6V1B2; TTC9C; SHPRH; TRAF2; OTUB1; TRIM32; RNF8; UBC35; U
  1. What is the species homology for "UBE2V2 Antibody - N-terminal region (ARP64751_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "UBE2V2 Antibody - N-terminal region (ARP64751_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "UBE2V2 Antibody - N-terminal region (ARP64751_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "UBE2V2 Antibody - N-terminal region (ARP64751_P050)"?

    This target may also be called "MMS2, UEV2, EDPF1, UEV-2, DDVIT1, EDAF-1, EDPF-1, DDVit-1" in publications.

  5. What is the shipping cost for "UBE2V2 Antibody - N-terminal region (ARP64751_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "UBE2V2 Antibody - N-terminal region (ARP64751_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "UBE2V2 Antibody - N-terminal region (ARP64751_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "UBE2V2 Antibody - N-terminal region (ARP64751_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "UBE2V2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "UBE2V2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "UBE2V2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "UBE2V2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "UBE2V2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "UBE2V2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:UBE2V2 Antibody - N-terminal region (ARP64751_P050)
Your Rating
We found other products you might like!